PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g011736m
Common NameCISIN_1g011736mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 479aa    MW: 53743.8 Da    PI: 6.2056
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g011736mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS463.11.6e-141494731374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cA++v++g+ e+a+  L+++s+laspdgd++qR+aayfteALa r+++ +++l kal++++ s  + +ee+ ++klf+e++P+lk
  orange1.1g011736m  49 LIHLLVACANHVAAGSVENANIGLEQISHLASPDGDTVQRIAAYFTEALADRMLKAWPGLHKALNSTKIS--SITEEIIVQKLFFELCPFLK 138
                        689*************************************************************999998..59****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                        +s++++NqaI+ea+ege++vHiiD++  +++QW++Llq+L++Rpegpp+lRiTg+++    +ke le+++ rL++ Ae+l++pf+fn+ +++
  orange1.1g011736m 139 LSYVITNQAIVEAMEGEKMVHIIDLNSFEPAQWINLLQTLSARPEGPPHLRITGIHE----QKEVLEQMALRLTEEAEKLDIPFQFNP-IVS 225
                        *********************************************************....9**************************.799 PP

               GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrll.............................................................. 214
                        +le+++le+L  k+gEalaV++vlq+hrll                                                              
  orange1.1g011736m 226 KLENVDLESL-RKTGEALAVSSVLQMHRLLatddemprrtspsasrtsssshlqrvlhmnrrtlgewlekdsvlmfspspdsasasastpls 316
                        9*********.589***********************************************************************9966433 PP

               GRAS 215 .desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaer 305
                         + s     +  ++L++++slsPkvvvv+eqe++hn++s++er++eal++y+a+fd+le++++r+s er+kvE++l+g+ei+n++aceg er
  orange1.1g011736m 317 lAASP----KMGSFLNALWSLSPKVVVVTEQESNHNGPSLMERVMEALNFYAAMFDCLESTMSRASIERQKVEKMLFGEEIKNIIACEGIER 404
                        33333....5677******************************************************************************* PP

               GRAS 306 rerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                        rerhe+lekW  rle aGF+ +pls++   qa++ll+ ++ dgy+++ee+g+lv++W+drpL+svSaWr
  orange1.1g011736m 405 RERHEKLEKWILRLELAGFGRMPLSYHGILQARRLLQSYGYDGYKIKEENGCLVICWQDRPLFSVSAWR 473
                        ********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.01623453IPR005202Transcription factor GRAS
PfamPF035145.4E-13949473IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MAGMVQEDGA SSVSSSPLQF FSMMSLSPAF GSPYPWLREL KSEERGLCLI HLLVACANHV  60
AAGSVENANI GLEQISHLAS PDGDTVQRIA AYFTEALADR MLKAWPGLHK ALNSTKISSI  120
TEEIIVQKLF FELCPFLKLS YVITNQAIVE AMEGEKMVHI IDLNSFEPAQ WINLLQTLSA  180
RPEGPPHLRI TGIHEQKEVL EQMALRLTEE AEKLDIPFQF NPIVSKLENV DLESLRKTGE  240
ALAVSSVLQM HRLLATDDEM PRRTSPSASR TSSSSHLQRV LHMNRRTLGE WLEKDSVLMF  300
SPSPDSASAS ASTPLSLAAS PKMGSFLNAL WSLSPKVVVV TEQESNHNGP SLMERVMEAL  360
NFYAAMFDCL ESTMSRASIE RQKVEKMLFG EEIKNIIACE GIERRERHEK LEKWILRLEL  420
AGFGRMPLSY HGILQARRLL QSYGYDGYKI KEENGCLVIC WQDRPLFSVS AWRFRRYD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-39494734375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438891.10.0hypothetical protein CICLE_v10031389mg
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A067GUE90.0A0A067GUE9_CITSI; Uncharacterized protein
STRINGVIT_13s0019g01220.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40982759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3